Anti Aging Cosmetic Grade Foxo4 D-Retro-Inverso Peptide 95% Foxo4-Dri 98% Senolytics Powder

Wuhan Senwayer century chemical Co..Ltd located in the predominant Wuhan City where is a traffic hinge of China, specialize in producing and developing pharmaceutical & its intermediates, Pesticide Intermediate, food additive, Plant extracts,and in distributing the products of our own company and affiliated enterprises.

We have set up R&D center, quality inspection center and manufacturing site in Wuhan, Jiangsu and other places.

Our company has professional staff who deal with chemical R&D and scientific management, and holds several sets of analyzing instruments with high efficiency and high sensitivity, such as HPLC, GC and Spectrophotometer. Meanwhile, we possess of complete Q.A. and Q.C. system, supply chemical products with good quality and custom-tailored products according to our clients' requirement.

We have professional sales team, focus on quality and service, and we have achieved excellent performance over the years. Our company is committed to the development of international market , our products are mainly exported to many countries and regions, such as Europe, America, South-east Asia, the Middle East and Africa etc. With our constant efforts and good service, We sincerely hope to establish long-term cooperation and common development with our customers.

Product description

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice